Marketplace.
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
image 1 of Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)

Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)

No ratings yet

£162.45

£162.45/each

Sold and sent by The Pool Cleaners

Delivered by post or courier

Delivery

  • £2.99 standard courier delivery by Mon 11 Aug

Returns

Returns available within 30 days.

Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)

No ratings yet

£162.45

£162.45/each

Description

Certikin Spafresh 0.5 Litre System Flush is an integral part of the Spafresh range, designed to provide you with all the essential chemicals needed to maintain and sanitize your spa or hot tub. This pack includes 6 bottles of the system flush, offering you a convenient and cost-effective solution for keeping your spa water clean and clear.One of the key benefits of using Certikin Spafresh System Flush is its ability to effectively remove any built-up residue, oils, and contaminants that may be present in your spa's plumbing system. By using this product regularly as part of your maintenance routine, you can ensure that your spa operates efficiently and that the water remains crystal clear.Each bottle contains 0.5 litres of the system flush solution, providing you with an ample amount to treat your spa multiple times. The concentrated formula means that you only need to use a small amount with each application, making it a long-lasting and reliable product for your spa maintenance needs.Regularly flushing your spa system with Certikin Spafresh helps to prevent the buildup of scale and biofilm, which can lead to clogged pipes and reduced water circulation. This not only prolongs the life of your spa equipment but also ensures that your spa water stays fresh and hygienic for a more enjoyable and relaxing experience.One of the unique selling points of Certikin Spafresh System Flush is its compatibility with a wide range of spa systems and hot tubs. Whether you have an acrylic, fiberglass, or vinyl spa, you can trust this product to effectively clean and maintain your system without causing any damage or corrosion.Using Certikin Spafresh System Flush is easy and straightforward. Simply follow the instructions provided on the packaging to add the appropriate amount to your spa water and let the formula work its magic. Within a short period, you will notice a significant improvement in water clarity and overall spa performance.Aside from its cleaning and sanitizing properties, Certikin Spafresh System Flush also helps to optimize the efficiency of your spa's filtration system. By removing impurities and deposits that can hinder the filtration process, this product ensures that your spa water is constantly circulated and filtered effectively.Furthermore, Certikin Spafresh System Flush is formulated to be environmentally friendly and safe for both your spa and its users. The gentle yet powerful formula is designed to provide thorough cleaning without harsh chemicals that could harm your spa equipment or the environment.For added convenience, Certikin provides detailed product documentation for the Spafresh range, allowing you to access additional information and guidance on using the various chemicals effectively. You can refer to the Spa Fresh brochure and specific product guides to ensure that you make the most of your spa maintenance routine.In conclusion, Certikin Spafresh 0.5 Litre System Flush is a must-have product for spa owners who prioritize cleanliness, efficiency, and longevity in their spa experience. With its effective cleaning power, compatibility with various spa systems, and environmentally friendly formula, this system flush is a reliable solution for maintaining your spa or hot tub in top condition.Manufacturers description:Certikin Spafresh 0.5 Litre System Flush - Pack Of 6The Spafresh range contains all the chemicals necessary for maintaining and sanitising a spa or hot tub. Take a look at the Spa Fresh brochure for more details.Product documentation:chem_br_spafresh_guide-573.pdf350msdsspafreshalkalinityincreaser201013-905.pdf351msdsspafreshhardnessincreaser151113-906.pdf352msdsspafreshsurfacecleaner201013-907.pdf355msdsspafreshphreducer201013-908.pdf356msdsspafreshphplus201013-909.pdf357msdsspafreshmultifunctionminichlorinetablets151113-910.pdf360msdsspafreshbrominetablets-un3085121113-911.pdf363msdsspafreshsystemflush040213-912.pdf365msdsspafreshfoamfree070114-913.pdfStock note: In an effort to provide the quickest possible delivery for our customers we may ship an alternative premium branded product if stocks are low. These brands will only be Blue Horizons, Deep Blue Pro, Relax or Swim Fresh, all established for a long time in the water treatment industry.
Sold by The Pool Cleaners (Ocean wave mobiles limited)

Delivery
  • £2.99 standard courier delivery by Mon 11 Aug
Returns

Not happy with a Marketplace item? You can request a return and refund online up to 30 days after the delivery date. You'll need to return the item to the Marketplace seller.Our returns policy

About Marketplace

We're giving you more choice than ever before. Shop more products from more brands across homewares, beauty, electricals and much more.

Sold and sent by trusted sellers right to your door.

No reviews yet

Help other customers like you

Reviews are submitted by our customers directly through our website. We also share reviews from other retailers' websites to help you make an informed decision.
Write a review